PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G062900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 288aa    MW: 31490.9 Da    PI: 6.365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G062900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.6e-163178148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +lv+ v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Sevir.3G062900.1.p 31 KGPWTEEEDAQLVRFVRLFGERRWDFLAKVSGLRRTGKSCRLRWVNYL 78
                        79********************************************97 PP

2Myb_DNA-binding51.91.7e-1684127146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rgr T++E+ l+v++++q+G++ W++Iar ++ gRt++++k++w++
  Sevir.3G062900.1.p  84 RGRITADEERLIVQLHAQWGTR-WSRIARSLP-GRTDNEIKNFWRT 127
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6682678IPR017930Myb domain
SuperFamilySSF466894.49E-2829125IPR009057Homeodomain-like
SMARTSM007171.7E-153080IPR001005SANT/Myb domain
PfamPF002494.2E-153178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-203285IPR009057Homeodomain-like
CDDcd001672.17E-113378No hitNo description
PROSITE profilePS5129422.83279133IPR017930Myb domain
SMARTSM007176.8E-1483131IPR001005SANT/Myb domain
PfamPF002496.7E-1484127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2286132IPR009057Homeodomain-like
CDDcd001673.06E-1088127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSMCSRNKDG EQIIIRAGGA AAAAAPATMR KGPWTEEEDA QLVRFVRLFG ERRWDFLAKV  60
SGLRRTGKSC RLRWVNYLHP GLRRGRITAD EERLIVQLHA QWGTRWSRIA RSLPGRTDNE  120
IKNFWRTRTR KKALEERRHG GDKTATAASP LSSSVTTASC CPGSPTTPSS SAAASSDDSA  180
LREGSGSGSG GDDAELEEAS TATAASQHQQ PQEYCCTMDQ LWNEIAAADA AASYVLDGWG  240
AAGHCYYGAA AEPPPMPSSP VWEYSSDYSL WRIDDEEYYR ETMLDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-27311334105MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-27311334105C-Myb DNA-Binding Domain
1mse_C3e-27311334105C-Myb DNA-Binding Domain
1h89_C1e-263113358159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-263113358159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283601e-140KJ728360.1 Zea mays clone pUT6642 MYB transcription factor (MYB62) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660308.10.0PREDICTED: transcription factor MYB59-like
TrEMBLK3ZD380.0K3ZD38_SETIT; Uncharacterized protein
STRINGSi024470m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-59myb domain protein 59